PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B00461.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 740aa    MW: 79649.8 Da    PI: 6.7464
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B00461.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.34.6e-16425463240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  Pahal.B00461.2 425 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 463
                     589**********************************96 PP

2TCR50.34.7e-16510549140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  Pahal.B00461.2 510 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNTF 549
                     589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17424465IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.046425550IPR005172CRC domain
PfamPF036388.3E-12427462IPR005172CRC domain
SMARTSM011143.5E-16510551IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.0E-11512548IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MDTPDRAAAQ QPPASRAEDS PVFSFINNLS PIEPLKSAYN ANSLQGYQSI NITSISSIFT  60
SPHDNVHKET RLAKSSLGEI SESEASAGGS KTNKPARSSN AVRLFACTST ITQETHTVTC  120
SDVADPPTGP CDLAQPAQFD NGSPDHNTTP CHGVRSDLKQ DKCRKLDAVQ AVKNTVEKRK  180
CLFSTEIQLL DGGQPVNDSD DVLGCEWSDL ISTTSGDSEI SGRAHPSASG QVYYQELVMG  240
EDQTENPQIF QDGQQTISTE EIQDNIYEPN GCIPLDYKVE SQQRGIRRRC LVFEAAGFSN  300
TVVQKETVES LSVSTCKGKS HVQTQPRGLR GIGLHLNALA LTPKGKMASQ DHMASGLRPS  360
LAEKDVHGKF LSAGENFPNS GGELLEFPMD DCSAGGFPVN DHVSSQSVSP QKKRRKTDNG  420
DDGEACKRCS CKKSKCLKLY CECFAAGVYC SEPCSCQGCL NKPIHEEIVL STRKQIEFRN  480
PLAFAPKVIR MSDAGPETGE DPNSTPASAR HKRGCNCKKS SCLKKYCECY QGGVGCSSNC  540
RCESCKNTFG RRDADSELIE EIKQEGEQTE NCGKEKENDQ QKANVQNEDH PLLDLVPITP  600
PFDLSSSLLK LPNFSSAKPP RPSKARSGNY RSSASKATAT LQSCKSSKVA GSAIDEGMPD  660
ILKEADSPNN CVKTTSPNGK RVSPPHNALS ISPNRKGGRK LILKSIPSFP SLMGESNSGS  720
AMNDTDNTFN ASPLVLGPS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1411415KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955607.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X2
TrEMBLK3ZQR90.0K3ZQR9_SETIT; Uncharacterized protein
STRINGSi028949m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.13e-87TESMIN/TSO1-like CXC 2